FAM81B antibody (N-Term)

Catalog No. ABIN632741

Product Details anti-FAM81B Antibody

Target: FAM81B (Family with Sequence Similarity 81, Member B (FAM81B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM81B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM81 B antibody was raised against the N terminal of FAM81

Purification: Affinity purified

Immunogen: FAM81 B antibody was raised using the N terminal of FAM81 corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM81B Blocking Peptide, catalog no. 33R-6333, is also available for use as a blocking control in assays to test for specificity of this FAM81B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM81B

Target: FAM81B (Family with Sequence Similarity 81, Member B (FAM81B))

Alternative Name: FAM81B (FAM81B Products)

Synonyms: family with sequence similarity 81 member B antibody, FAM81B antibody

Background: The specific function of FAM81B is not yet known.

Molecular Weight: 52 kDa (MW of target protein)