KRT222 antibody (N-Term)

Catalog No. ABIN632733

Product Details anti-KRT222 Antibody

Target: KRT222 (Keratin 222 (KRT222))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT222 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222 P

Purification: Affinity purified

Immunogen: Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222 P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 222 Pseudogene Blocking Peptide, catalog no. 33R-2575, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 222 Pseudogene antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT220 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT222

Target: KRT222 (Keratin 222 (KRT222))

Abstract: KRT222 Products

Synonyms: KRT222P antibody, KA21 antibody, 6330509G02Rik antibody, keratin 222 antibody, KRT222 antibody, Krt222 antibody

Background: KRT222P belongs to the intermediate filament family. The exact function of KRT222P is not known.

Molecular Weight: 34 kDa (MW of target protein)