LSM12B antibody

Catalog No. ABIN632732

Product Details anti-LSM12B Antibody

Target: LSM12B (LSM12 Homolog B (LSM12B))

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSM12B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSM12 Blocking Peptide, catalog no. 33R-7290, is also available for use as a blocking control in assays to test for specificity of this LSM12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSM12B

Target: LSM12B (LSM12 Homolog B (LSM12B))

Alternative Name: LSM12 (LSM12B Products)

Synonyms: 1110032E16Rik antibody, 1110059P07 antibody, 2600001B17Rik antibody, RGD1309441 antibody, lsm12 antibody, lsm12a antibody, wu:fe01f11 antibody, zgc:66039 antibody, LSM12 antibody, PNAS-135 antibody, LSM12 homolog antibody, LSM12 homolog b antibody, Lsm12 antibody, lsm12b antibody, LSM12 antibody

Background: LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.

Molecular Weight: 22 kDa (MW of target protein)