C16ORF46 antibody (N-Term)

Catalog No. ABIN632731

Product Details anti-C16ORF46 Antibody

Target: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C16ORF46 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 ORF46 antibody was raised against the N terminal Of C16 rf46

Purification: Affinity purified

Immunogen: C16 ORF46 antibody was raised using the N terminal Of C16 rf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16ORF46 Blocking Peptide, catalog no. 33R-5431, is also available for use as a blocking control in assays to test for specificity of this C16ORF46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C16ORF46

Target: C16ORF46 (Chromosome 16 Open Reading Frame 46 (C16ORF46))

Alternative Name: C16ORF46 (C16ORF46 Products)

Synonyms: chromosome 16 open reading frame 46 antibody, chromosome 18 open reading frame, human C16orf46 antibody, chromosome 16 C16orf46 homolog antibody, C16orf46 antibody, C18H16orf46 antibody, C16H16orf46 antibody

Background: The function of C16orf46 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 43 kDa (MW of target protein)