PACRGL antibody (Middle Region)

Catalog No. ABIN632727

Product Details anti-PACRGL Antibody

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PACRGL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 ORF28 antibody was raised against the middle region of C4 rf28

Purification: Affinity purified

Immunogen: C4 ORF28 antibody was raised using the middle region of C4 rf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF28 Blocking Peptide, catalog no. 33R-7248, is also available for use as a blocking control in assays to test for specificity of this C4ORF28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PACRGL

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Alternative Name: C4ORF28 (PACRGL Products)

Synonyms: RGD1311045 antibody, C4orf28 antibody, 4933428G09Rik antibody, parkin coregulated like antibody, parkin coregulated like L homeolog antibody, PARK2 co-regulated-like antibody, Pacrgl antibody, PACRGL antibody, pacrgl antibody, pacrgl.L antibody

Background: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)