DYDC1 antibody (Middle Region)

Catalog No. ABIN632723

Product Details anti-DYDC1 Antibody

Target: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DYDC1 antibody was raised against the middle region of DYDC1

Purification: Affinity purified

Immunogen: DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYDC1 Blocking Peptide, catalog no. 33R-2315, is also available for use as a blocking control in assays to test for specificity of this DYDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYDC1

Target: DYDC1 (DPY30 Domain Containing 1 (DYDC1))

Alternative Name: DYDC1 (DYDC1 Products)

Synonyms: DPY30D1 antibody, 1700029M23Rik antibody, DPY30 domain containing 1 antibody, DPY30 domain containing 1 L homeolog antibody, DYDC1 antibody, dydc1.L antibody, Dydc1 antibody

Background: DYDC1 plays a crucial role during acrosome biogenesis.

Molecular Weight: 21 kDa (MW of target protein)