FAM83F antibody (Middle Region)

Catalog No. ABIN632716

Product Details anti-FAM83F Antibody

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM83F antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM83 F antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogen: FAM83 F antibody was raised using the middle region of FAM83 corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM83F Blocking Peptide, catalog no. 33R-3043, is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM83F

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Alternative Name: FAM83F (FAM83F Products)

Synonyms: AW544981 antibody, RGD1562089 antibody, zgc:92122 antibody, family with sequence similarity 83, member F antibody, family with sequence similarity 83 member F antibody, family with sequence similarity 83, member Fb antibody, Fam83f antibody, FAM83F antibody, fam83fb antibody

Background: The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 55 kDa (MW of target protein)