JOSD2 antibody (N-Term)

Catalog No. ABIN632715

Product Details anti-JOSD2 Antibody

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JOSD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: JOSD2 antibody was raised against the N terminal of JOSD2

Purification: Affinity purified

Immunogen: JOSD2 antibody was raised using the N terminal of JOSD2 corresponding to a region with amino acids QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JOSD2 Blocking Peptide, catalog no. 33R-7694, is also available for use as a blocking control in assays to test for specificity of this JOSD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JOSD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JOSD2

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Alternative Name: JOSD2 (JOSD2 Products)

Synonyms: 1110007C05Rik antibody, RGD1307305 antibody, zgc:55937 antibody, Josephin domain containing 2 antibody, Josephin domain containing 2 L homeolog antibody, Josd2 antibody, josd2.L antibody, JOSD2 antibody, josd2 antibody

Background: The specific function of JOSD2 is not yet known.

Molecular Weight: 21 kDa (MW of target protein)