KIAA1958 antibody (C-Term)

Catalog No. ABIN632714

Product Details anti-KIAA1958 Antibody

Target: KIAA1958

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIAA1958 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1958 antibody was raised against the C terminal of KIAA1958

Purification: Affinity purified

Immunogen: KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1958 Blocking Peptide, catalog no. 33R-8678, is also available for use as a blocking control in assays to test for specificity of this KIAA1958 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1958 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIAA1958

Target: KIAA1958

Alternative Name: KIAA1958 (KIAA1958 Products)

Synonyms: KIAA1958 antibody, KIAA1958 ortholog antibody, KIAA1958 antibody, kiaa1958 antibody

Background: The function of KIAA1958 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 62 kDa (MW of target protein)