ACOT12 antibody (Middle Region)
-
- Target See all ACOT12 Antibodies
- ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACOT12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACOT12 antibody was raised against the middle region of ACOT12
- Purification
- Affinity purified
- Immunogen
- ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV
- Top Product
- Discover our top product ACOT12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACOT12 Blocking Peptide, catalog no. 33R-8317, is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))
- Alternative Name
- ACOT12 (ACOT12 Products)
- Background
- ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.
- Molecular Weight
- 62 kDa (MW of target protein)
-