DUSP19 antibody (C-Term)

Catalog No. ABIN632710

Product Details anti-DUSP19 Antibody

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUSP19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DUSP19 antibody was raised against the C terminal of DUSP19

Purification: Affinity purified

Immunogen: DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUSP19 Blocking Peptide, catalog no. 33R-8399, is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUSP19

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Alternative Name: DUSP19 (DUSP19 Products)

Synonyms: Dusp19 antibody, skrp1 antibody, dusp17 antibody, ts-dsp1 antibody, MGC85046 antibody, si:dkey-237j22.1 antibody, DKFZp469B171 antibody, DUSP17 antibody, LMWDSP3 antibody, SKRP1 antibody, TS-DSP1 antibody, 5930436K22Rik antibody, C79103 antibody, dual specificity phosphatase 19b antibody, dual specificity phosphatase 19 antibody, dual specificity phosphatase 19 L homeolog antibody, dual specificity phosphatase 19a antibody, dusp19b antibody, DUSP19 antibody, dusp19 antibody, dusp19.L antibody, dusp19a antibody, Dusp19 antibody

Background: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Molecular Weight: 24 kDa (MW of target protein)