Sialidase 4 antibody (N-Term)

Catalog No. ABIN632708

Product Details anti-Sialidase 4 Antibody

Target: Sialidase 4 (NEU4)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sialidase 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NEU4 antibody was raised against the N terminal of NEU4

Purification: Affinity purified

Immunogen: NEU4 antibody was raised using the N terminal of NEU4 corresponding to a region with amino acids TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NEU4 Blocking Peptide, catalog no. 33R-9097, is also available for use as a blocking control in assays to test for specificity of this NEU4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEU4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sialidase 4

Target: Sialidase 4 (NEU4)

Alternative Name: NEU4 (NEU4 Products)

Synonyms: 9330166I04 antibody, neuraminidase 4 antibody, sialidase 4 antibody, NEU4 antibody, Neu4 antibody

Background: NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.

Molecular Weight: 53 kDa (MW of target protein)