C20orf141 antibody (Middle Region)

Catalog No. ABIN632707

Product Details anti-C20orf141 Antibody

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C20orf141 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF141 antibody was raised against the middle region of C20 rf141

Purification: Affinity purified

Immunogen: C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF141 Blocking Peptide, catalog no. 33R-3864, is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C20orf141

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Alternative Name: C20ORF141 (C20orf141 Products)

Synonyms: dJ860F19.4 antibody, chromosome 20 open reading frame 141 antibody, chromosome 10 C20orf141 homolog antibody, C20orf141 antibody, C10H20orf141 antibody

Background: The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 17 kDa (MW of target protein)