C8orf34 antibody (N-Term)

Catalog No. ABIN632705

Product Details anti-C8orf34 Antibody

Target: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C8orf34 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C8 ORF34 antibody was raised against the N terminal Of C8 rf34

Purification: Affinity purified

Immunogen: C8 ORF34 antibody was raised using the N terminal Of C8 rf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C8ORF34 Blocking Peptide, catalog no. 33R-6548, is also available for use as a blocking control in assays to test for specificity of this C8ORF34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C8orf34

Target: C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))

Alternative Name: C8ORF34 (C8orf34 Products)

Synonyms: C2H8orf34 antibody, VEST-1 antibody, VEST1 antibody, C8orf34 antibody, chromosome 2 open reading frame, human C8orf34 antibody, chromosome 8 open reading frame 34 antibody, chromosome 29 C8orf34 homolog antibody, C2H8ORF34 antibody, C8orf34 antibody, C29H8orf34 antibody

Background: The function of C8orf34 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 47 kDa (MW of target protein)