C8orf34 antibody (N-Term)
-
- Target See all C8orf34 products
- C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C8orf34 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C8 ORF34 antibody was raised against the N terminal Of C8 rf34
- Purification
- Affinity purified
- Immunogen
- C8 ORF34 antibody was raised using the N terminal Of C8 rf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C8ORF34 Blocking Peptide, catalog no. 33R-6548, is also available for use as a blocking control in assays to test for specificity of this C8ORF34 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF34 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C8orf34 (Chromosome 8 Open Reading Frame 34 (C8orf34))
- Alternative Name
- C8ORF34 (C8orf34 Products)
- Background
- The function of C8orf34 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 47 kDa (MW of target protein)
-