LRRC42 antibody (N-Term)

Catalog No. ABIN632704

Product Details anti-LRRC42 Antibody

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC42 antibody was raised against the N terminal of LRRC42

Purification: Affinity purified

Immunogen: LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC42 Blocking Peptide, catalog no. 33R-5043, is also available for use as a blocking control in assays to test for specificity of this LRRC42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC42

Target: LRRC42 (Leucine Rich Repeat Containing 42 (LRRC42))

Alternative Name: LRRC42 (LRRC42 Products)

Synonyms: dJ167A19.4 antibody, A930011F22Rik antibody, AA536996 antibody, RGD1308919 antibody, wu:fe17g08 antibody, zgc:56446 antibody, zgc:77847 antibody, leucine rich repeat containing 42 antibody, leucine rich repeat containing 42 L homeolog antibody, LRRC42 antibody, Lrrc42 antibody, lrrc42.L antibody, lrrc42 antibody

Background: The function of LRRC42 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 48 kDa (MW of target protein)