SERPINB1 antibody

Catalog No. ABIN632703

Product Details anti-SERPINB1 Antibody

Target: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINB1 Blocking Peptide, catalog no. 33R-8251, is also available for use as a blocking control in assays to test for specificity of this SERPINB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINB1

Target: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Alternative Name: SERPINB1 (SERPINB1 Products)

Synonyms: ELANH2 antibody, zgc:91981 antibody, si:dkey-177p2.11 antibody, si:dkey-177p2.12 antibody, EI antibody, LEI antibody, M/NEI antibody, MNEI antibody, PI-2 antibody, PI2 antibody, elanh2 antibody, lei antibody, m/nei antibody, mnei antibody, pi2 antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 antibody, serpin family B member 1 antibody, serpin family B member 1 L homeolog antibody, SERPINB1 antibody, serpinb1 antibody, serpinb1.L antibody

Background: SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.

Molecular Weight: 43 kDa (MW of target protein)