SLU7 antibody
-
- Target See all SLU7 Antibodies
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLU7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH
- Top Product
- Discover our top product SLU7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLU7 Blocking Peptide, catalog no. 33R-4475, is also available for use as a blocking control in assays to test for specificity of this SLU7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLU7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
- Alternative Name
- SLU7 (SLU7 Products)
- Synonyms
- 9G8 antibody, hSlu7 antibody, AU018913 antibody, D11Ertd730e antibody, D3Bwg0878e antibody, 9g8 antibody, hslu7 antibody, wu:fc94e11 antibody, zgc:103640 antibody, CG1420 antibody, Dmel\\CG1420 antibody, SLU7 antibody, SLU7 homolog, splicing factor antibody, SLU7 splicing factor homolog (S. cerevisiae) antibody, SLU7 homolog, splicing factor L homeolog antibody, CG1420 gene product from transcript CG1420-RA antibody, SLU7 antibody, Slu7 antibody, slu7.L antibody, slu7 antibody
- Target Type
- Influenza Protein
- Background
- Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome
-