C4orf33 antibody (C-Term)

Catalog No. ABIN632694

Product Details anti-C4orf33 Antibody

Target: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4orf33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 ORF33 antibody was raised against the C terminal Of C4 rf33

Purification: Affinity purified

Immunogen: C4 ORF33 antibody was raised using the C terminal Of C4 rf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4orf33

Target: C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))

Alternative Name: C4ORF33 (C4orf33 Products)

Synonyms: C4H4orf33 antibody, MGC108272 antibody, MGC197879 antibody, chromosome 4 open reading frame 33 antibody, chromosome 4 C4orf33 homolog antibody, zgc:77739 antibody, C4orf33 antibody, C4H4orf33 antibody, c4orf33 antibody, zgc:77739 antibody

Background: C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.

Molecular Weight: 23 kDa (MW of target protein)