C4orf33 antibody (C-Term)
-
- Target See all C4orf33 products
- C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C4orf33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C4 ORF33 antibody was raised against the C terminal Of C4 rf33
- Purification
- Affinity purified
- Immunogen
- C4 ORF33 antibody was raised using the C terminal Of C4 rf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C4ORF33 Blocking Peptide, catalog no. 33R-7238, is also available for use as a blocking control in assays to test for specificity of this C4ORF33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C4orf33 (Chromosome 4 Open Reading Frame 33 (C4orf33))
- Alternative Name
- C4ORF33 (C4orf33 Products)
- Background
- C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.
- Molecular Weight
- 23 kDa (MW of target protein)
-