LRRC17 antibody (Middle Region)
-
- Target See all LRRC17 Antibodies
- LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC17 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC17 antibody was raised against the middle region of LRRC17
- Purification
- Affinity purified
- Immunogen
- LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
- Top Product
- Discover our top product LRRC17 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC17 Blocking Peptide, catalog no. 33R-10275, is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))
- Alternative Name
- LRRC17 (LRRC17 Products)
- Synonyms
- P37NB antibody, 37kDa antibody, 4833425M04Rik antibody, 6130400C22Rik antibody, P37nb antibody, leucine rich repeat containing 17 antibody, Lrrc17 antibody, LRRC17 antibody
- Background
- LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.
- Molecular Weight
- 52 kDa (MW of target protein)
-