LIPJ antibody (C-Term)

Catalog No. ABIN632690

Product Details anti-LIPJ Antibody

Target: LIPJ (Lipase, Family Member J (LIPJ))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIPJ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Lipase J antibody was raised against the C terminal of LIPJ

Purification: Affinity purified

Immunogen: Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipase J Blocking Peptide, catalog no. 33R-5229, is also available for use as a blocking control in assays to test for specificity of this Lipase J antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIPJ

Target: LIPJ (Lipase, Family Member J (LIPJ))

Alternative Name: Lipase J (LIPJ Products)

Synonyms: LIPL1 antibody, bA425M17.2 antibody, lipase family member J antibody, LIPJ antibody

Background: LIPJ belongs to the AB hydrolase superfamily, lipase family. The exact function of LIPJ remains unknown.

Molecular Weight: 42 kDa (MW of target protein)