PPP1R27 antibody (Middle Region)
-
- Target See all PPP1R27 Antibodies
- PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1R27 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DYSFIP1 antibody was raised against the middle region of DYSFIP1
- Purification
- Affinity purified
- Immunogen
- DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK
- Top Product
- Discover our top product PPP1R27 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DYSFIP1 Blocking Peptide, catalog no. 33R-1976, is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))
- Alternative Name
- DYSFIP1 (PPP1R27 Products)
- Synonyms
- DYSFIP1 antibody, 1110033I14Rik antibody, Dysfip1 antibody, toonin antibody, RGD1308861 antibody, protein phosphatase 1 regulatory subunit 27 antibody, protein phosphatase 1, regulatory subunit 27 antibody, PPP1R27 antibody, Ppp1r27 antibody
- Background
- The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 17 kDa (MW of target protein)
-