FAM113A antibody (C-Term)

Catalog No. ABIN632680

Product Details anti-FAM113A Antibody

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM113A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM113 A antibody was raised against the C terminal of FAM113

Purification: Affinity purified

Immunogen: FAM113 A antibody was raised using the C terminal of FAM113 corresponding to a region with amino acids YPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM113A Blocking Peptide, catalog no. 33R-10201, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM113A

Target: FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))

Alternative Name: FAM113A (FAM113A Products)

Synonyms: C20orf81 antibody, FAM113A antibody, bA12M19.1 antibody, A930025D01Rik antibody, AI480484 antibody, Fam113a antibody, RGD1308836 antibody, PC-esterase domain containing 1A antibody, PCED1A antibody, Pced1a antibody

Background: FAM113A is involved in protein binding and hydrolase activity.

Molecular Weight: 52 kDa (MW of target protein)