FAM113A antibody (N-Term)
-
- Target See all FAM113A Antibodies
- FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM113A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM113 A antibody was raised against the N terminal of FAM113
- Purification
- Affinity purified
- Immunogen
- FAM113 A antibody was raised using the N terminal of FAM113 corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC
- Top Product
- Discover our top product FAM113A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM113A Blocking Peptide, catalog no. 33R-9674, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM113A (Family with Sequence Similarity 113, Member A (FAM113A))
- Alternative Name
- FAM113A (FAM113A Products)
- Synonyms
- C20orf81 antibody, FAM113A antibody, bA12M19.1 antibody, A930025D01Rik antibody, AI480484 antibody, Fam113a antibody, RGD1308836 antibody, PC-esterase domain containing 1A antibody, PCED1A antibody, Pced1a antibody
- Background
- FAM113A is involved in protein binding and hydrolase activity.
- Molecular Weight
- 52 kDa (MW of target protein)
-