TRUB2 antibody (N-Term)

Catalog No. ABIN632678

Product Details anti-TRUB2 Antibody

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRUB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRUB2 antibody was raised against the N terminal of TRUB2

Purification: Affinity purified

Immunogen: TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRUB2 Blocking Peptide, catalog no. 33R-6072, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRUB2

Target: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Alternative Name: TRUB2 (TRUB2 Products)

Synonyms: CLONE24922 antibody, RP11-339B21.1 antibody, G430055L02Rik antibody, fc51e05 antibody, wu:fc51e05 antibody, zgc:91836 antibody, TruB pseudouridine synthase family member 2 antibody, TruB pseudouridine (psi) synthase family member 2 antibody, TruB pseudouridine (psi) synthase homolog 2 (E. coli) antibody, TruB pseudouridine (psi) synthase family member 2 L homeolog antibody, TRUB2 antibody, trub2 antibody, trub2.L antibody, Trub2 antibody

Background: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

Molecular Weight: 37 kDa (MW of target protein)