TRUB2 antibody (N-Term)
-
- Target See all TRUB2 Antibodies
- TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRUB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRUB2 antibody was raised against the N terminal of TRUB2
- Purification
- Affinity purified
- Immunogen
- TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
- Top Product
- Discover our top product TRUB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRUB2 Blocking Peptide, catalog no. 33R-6072, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))
- Alternative Name
- TRUB2 (TRUB2 Products)
- Background
- Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.
- Molecular Weight
- 37 kDa (MW of target protein)
-