HOMER1 antibody
-
- Target See all HOMER1 Antibodies
- HOMER1 (Homer Homolog 1 (HOMER1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HOMER1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
- Top Product
- Discover our top product HOMER1 Primary Antibody
-
-
- Application Notes
-
WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HOMER1 Blocking Peptide, catalog no. 33R-2502, is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HOMER1 (Homer Homolog 1 (HOMER1))
- Alternative Name
- HOMER1 (HOMER1 Products)
- Background
- HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-