HOMER1 antibody

Catalog No. ABIN632669

Product Details anti-HOMER1 Antibody

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HOMER1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Application Details

Application Notes: WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HOMER1 Blocking Peptide, catalog no. 33R-2502, is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HOMER1

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Alternative Name: HOMER1 (HOMER1 Products)

Synonyms: HOMER antibody, HOMER1A antibody, HOMER1B antibody, HOMER1C antibody, SYN47 antibody, Ves-1 antibody, HOMER1 antibody, PSD-Zip45 antibody, homer1 antibody, zgc:100854 antibody, zgc:92844 antibody, HOMER1F antibody, Vesl-1 antibody, homer antibody, xhomer1 antibody, BEST:LD03829 antibody, CG11324 antibody, Dhom antibody, Dhomer antibody, Dm Homer antibody, Dmel\CG11324 antibody, Dvh antibody, Hom antibody, Homer antibody, LD03829 antibody, dhom antibody, homer scaffolding protein 1 antibody, homer scaffolding protein 1b antibody, homer scaffolding protein 1 L homeolog antibody, CG11324 gene product from transcript CG11324-RD antibody, HOMER1 antibody, Homer1 antibody, homer1b antibody, homer1.L antibody, homer antibody

Background: HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development