CAMK1G antibody (N-Term)

Catalog No. ABIN632661

Product Details anti-CAMK1G Antibody

Target: CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAMK1G antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CAMK1 G antibody was raised against the N terminal of CAMK1

Purification: Affinity purified

Immunogen: CAMK1 G antibody was raised using the N terminal of CAMK1 corresponding to a region with amino acids SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAMK1G Blocking Peptide, catalog no. 33R-8410, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAMK1G

Target: CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))

Alternative Name: CAMK1G (CAMK1G Products)

Synonyms: camk1g antibody, wu:fk53c02 antibody, zgc:73127 antibody, CAMK1G antibody, Ci-CaM-K antibody, wu:fk61c03 antibody, zgc:73155 antibody, CLICK-III antibody, CaMKIgamma antibody, CLICK3 antibody, CLICKIII antibody, VWS1 antibody, dJ272L16.1 antibody, calcium/calmodulin-dependent protein kinase IGa antibody, calcium/calmodulin-dependent protein kinase IG antibody, calmodulin-dependent protein kinase homologue antibody, calcium/calmodulin dependent protein kinase IG antibody, calcium/calmodulin-dependent protein kinase IGb antibody, calcium/calmodulin-dependent protein kinase I gamma antibody, camk1ga antibody, CAMK1G antibody, cam-k antibody, camk1gb antibody, Camk1g antibody

Background: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Molecular Weight: 53 kDa (MW of target protein)