CHMP1B antibody (N-Term)
-
- Target See all CHMP1B Antibodies
- CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHMP1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHMP1 B antibody was raised against the N terminal of CHMP1
- Purification
- Affinity purified
- Immunogen
- CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
- Top Product
- Discover our top product CHMP1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHMP1B Blocking Peptide, catalog no. 33R-4435, is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))
- Alternative Name
- CHMP1B (CHMP1B Products)
- Background
- CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.
- Molecular Weight
- 22 kDa (MW of target protein)
-