DDHD2 antibody (N-Term)

Catalog No. ABIN632655

Product Details anti-DDHD2 Antibody

Target: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDHD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DDHD2 antibody was raised against the N terminal of DDHD2

Purification: Affinity purified

Immunogen: DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDHD2 Blocking Peptide, catalog no. 33R-1971, is also available for use as a blocking control in assays to test for specificity of this DDHD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDHD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDHD2

Target: DDHD2 (DDHD Domain Containing 2 (DDHD2))

Alternative Name: DDHD2 (DDHD2 Products)

Synonyms: SAMWD1 antibody, SPG54 antibody, 2010305K11Rik antibody, mKIAA0725 antibody, DDHD domain containing 2 antibody, DDHD2 antibody, Ddhd2 antibody, ddhd2 antibody

Background: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Molecular Weight: 81 kDa (MW of target protein)