FAM160B1 antibody (N-Term)

Catalog No. ABIN632652

Product Details anti-FAM160B1 Antibody

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM160B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM160 B1 antibody was raised against the N terminal of FAM160 1

Purification: Affinity purified

Immunogen: FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM160B1 Blocking Peptide, catalog no. 33R-3884, is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM160B1

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Alternative Name: FAM160B1 (FAM160B1 Products)

Synonyms: zgc:162264 antibody, kiaa1600 antibody, KIAA1600 antibody, bA106M7.3 antibody, AI450540 antibody, mKIAA1600 antibody, RGD1306116 antibody, family with sequence similarity 160, member B1 antibody, family with sequence similarity 160 member B1 antibody, family with sequence similarity 160 member B1 S homeolog antibody, fam160b1 antibody, FAM160B1 antibody, Fam160b1 antibody, fam160b1.S antibody

Background: The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 86 kDa (MW of target protein)