GPALPP1 antibody (Middle Region)

Catalog No. ABIN632646

Product Details anti-GPALPP1 Antibody

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPALPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA1704 antibody was raised against the middle region of KIAA1704

Purification: Affinity purified

Immunogen: KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1704 Blocking Peptide, catalog no. 33R-4232, is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1704 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPALPP1

Target: GPALPP1 (GPALPP Motifs Containing 1 (GPALPP1))

Alternative Name: KIAA1704 (GPALPP1 Products)

Synonyms: KIAA1704 antibody, LSR7 antibody, RP11-245H20.2 antibody, bA245H20.2 antibody, 1200011I18Rik antibody, Kiaa1704 antibody, fc50h08 antibody, wu:fc50h08 antibody, zgc:91844 antibody, GPALPP motifs containing 1 antibody, GPALPP1 antibody, Gpalpp1 antibody, gpalpp1 antibody

Background: The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 38 kDa (MW of target protein)