LRRC23 antibody (N-Term)

Catalog No. ABIN632645

Product Details anti-LRRC23 Antibody

Target: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC23 antibody was raised against the N terminal of LRRC23

Purification: Affinity purified

Immunogen: LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC23 Blocking Peptide, catalog no. 33R-4931, is also available for use as a blocking control in assays to test for specificity of this LRRC23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC23

Target: LRRC23 (Leucine Rich Repeat Containing 23 (LRRC23))

Alternative Name: LRRC23 (LRRC23 Products)

Synonyms: LRPB7 antibody, 4921537K05Rik antibody, B7 antibody, Lrpb7 antibody, leucine rich repeat containing 23 antibody, LRRC23 antibody, Lrrc23 antibody

Background: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Molecular Weight: 40 kDa (MW of target protein)