PLSCR1 antibody (N-Term)

Catalog No. ABIN632641

Product Details anti-PLSCR1 Antibody

Target: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLSCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLSCR1 antibody was raised against the N terminal of PLSCR1

Purification: Affinity purified

Immunogen: PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLSCR1 Blocking Peptide, catalog no. 33R-5843, is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLSCR1

Target: PLSCR1 (phospholipid Scramblase 1 (PLSCR1))

Alternative Name: PLSCR1 (PLSCR1 Products)

Synonyms: mmtra1b antibody, MGC84969 antibody, PLSCR1 antibody, MGC148322 antibody, MMTRA1B antibody, MmTRA1a antibody, MmTRA1b antibody, Nor1 antibody, Tra1 antibody, Tra1a antibody, Tra1b antibody, Tras1 antibody, Tras2 antibody, PLSCR2 antibody, phospholipid scramblase 1 L homeolog antibody, phospholipid scramblase 1 antibody, plscr1.L antibody, PLS1 antibody, PVX_111580 antibody, PLSCR1 antibody, plscr1 antibody, Plscr1 antibody, LOC100712949 antibody, PLSCR2 antibody, LOC100341366 antibody, LOC611500 antibody

Background: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin