PLSCR1 antibody (N-Term)
-
- Target See all PLSCR1 Antibodies
- PLSCR1 (phospholipid Scramblase 1 (PLSCR1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLSCR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLSCR1 antibody was raised against the N terminal of PLSCR1
- Purification
- Affinity purified
- Immunogen
- PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
- Top Product
- Discover our top product PLSCR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLSCR1 Blocking Peptide, catalog no. 33R-5843, is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLSCR1 (phospholipid Scramblase 1 (PLSCR1))
- Alternative Name
- PLSCR1 (PLSCR1 Products)
- Background
- PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin
-