THNSL2 antibody
-
- Target See all THNSL2 Antibodies
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This THNSL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
- Top Product
- Discover our top product THNSL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THNSL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THNSL2 (threonine Synthase-Like 2 (THNSL2))
- Alternative Name
- THNSL2 (THNSL2 Products)
- Synonyms
- BC051244 antibody, TSH2 antibody, SOFAT antibody, THS2 antibody, RGD1309144 antibody, Tsh2 antibody, zgc:123281 antibody, threonine synthase-like 2 (bacterial) antibody, threonine synthase like 2 antibody, threonine synthase-like 2 antibody, Thnsl2 antibody, THNSL2 antibody, thnsl2 antibody
- Background
- THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.
- Molecular Weight
- 54 kDa (MW of target protein)
-