PLAT antibody (Middle Region)
-
- Target See all PLAT Antibodies
- PLAT (Plasminogen Activator, Tissue (PLAT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLAT antibody was raised against the middle region of PLAT
- Purification
- Affinity purified
- Immunogen
- PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR
- Top Product
- Discover our top product PLAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLAT Blocking Peptide, catalog no. 33R-9356, is also available for use as a blocking control in assays to test for specificity of this PLAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLAT (Plasminogen Activator, Tissue (PLAT))
- Alternative Name
- PLAT (PLAT Products)
- Synonyms
- T-PA antibody, TPA antibody, AU020998 antibody, AW212668 antibody, D8Ertd2e antibody, tPA antibody, PATISS antibody, tpa antibody, Plat antibody, plat antibody, t-pa antibody, plasminogen activator, tissue type antibody, plasminogen activator, tissue antibody, chromosome 20 open reading frame 181 antibody, plasminogen activator, tissue L homeolog antibody, PLAT antibody, Plat antibody, plat antibody, C20orf181 antibody, plat.L antibody
- Background
- This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Autophagy, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, SARS-CoV-2 Protein Interactome
-