RPE antibody (N-Term)
-
- Target See all RPE Antibodies
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPE antibody was raised against the N terminal of RPE
- Purification
- Affinity purified
- Immunogen
- RPE antibody was raised using the N terminal of RPE corresponding to a region with amino acids ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ
- Top Product
- Discover our top product RPE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPE Blocking Peptide, catalog no. 33R-1339, is also available for use as a blocking control in assays to test for specificity of this RPE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
- Alternative Name
- RPE (RPE Products)
- Background
- RPE is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle.
- Molecular Weight
- 19 kDa (MW of target protein)
-