PLA2G4E antibody (C-Term)

Catalog No. ABIN632624

Product Details anti-PLA2G4E Antibody

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLA2G4E antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLA2 G2 antibody was raised against the c terminal of PLA2 2

Purification: Affinity purified

Immunogen: PLA2 G2 antibody was raised using the C terminal of PLA2 2 corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLA2G4E Blocking Peptide, catalog no. 33R-9063, is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLA2G4E

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Alternative Name: PLA2G4E (PLA2G4E Products)

Synonyms: RGD1310595 antibody, 2310026J01Rik antibody, C230096D22 antibody, Pla2epsilon antibody, phospholipase A2, group IVE antibody, phospholipase A2 group IVE-like 6 antibody, phospholipase A2 group IVE antibody, Pla2g4e antibody, PLA2G4EL6 antibody, PLA2G4E antibody

Background: PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, VEGF Signaling