SPATA24 antibody (C-Term)
-
- Target See all SPATA24 Antibodies
- SPATA24 (Spermatogenesis Associated 24 (SPATA24))
- Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPATA24 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- SPATA24 antibody was raised against the c terminal of SPATA24
- Purification
- Affinity purified
- Immunogen
- SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
- Top Product
- Discover our top product SPATA24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPATA24 Blocking Peptide, catalog no. 33R-5332, is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA24 (Spermatogenesis Associated 24 (SPATA24))
- Alternative Name
- SPATA24 (SPATA24 Products)
- Background
- SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.
- Molecular Weight
- 23 kDa (MW of target protein)
-