AKR1C2 antibody
-
- Target See all AKR1C2 Antibodies
- AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AKR1C2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AKR1 C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
- Top Product
- Discover our top product AKR1C2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AKR1C2 Blocking Peptide, catalog no. 33R-1968, is also available for use as a blocking control in assays to test for specificity of this AKR1C2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR1C2 (Aldo-keto Reductase Family 1, Member C2 (AKR1C2))
- Alternative Name
- AKR1C2 (AKR1C2 Products)
- Synonyms
- AKR1C-pseudo antibody, BABP antibody, DD antibody, DD2 antibody, DDH2 antibody, HAKRD antibody, HBAB antibody, MCDR2 antibody, SRXY8 antibody, Akr1c21 antibody, aldo-keto reductase family 1 member C2 antibody, aldo-keto reductase family 1, member C2 antibody, AKR1C2 antibody, Akr1c2 antibody
- Background
- This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process
-