ZPBP2 antibody (Middle Region)

Catalog No. ABIN632617

Product Details anti-ZPBP2 Antibody

Target: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZPBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZPBP2 antibody was raised against the middle region of ZPBP2

Purification: Affinity purified

Immunogen: ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZPBP2 Blocking Peptide, catalog no. 33R-9776, is also available for use as a blocking control in assays to test for specificity of this ZPBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZPBP2

Target: ZPBP2 (Zona Pellucida Binding Protein 2 (ZPBP2))

Alternative Name: ZPBP2 (ZPBP2 Products)

Synonyms: ZPBP2 antibody, ZPBPL antibody, 1700017D11Rik antibody, 2610022C02Rik antibody, zona pellucida binding protein 2 antibody, ZPBP2 antibody, Zpbp2 antibody

Background: ZPBP2 may be implicated in gamete interaction during fertilization.

Molecular Weight: 35 kDa (MW of target protein)