XRRA1 antibody (N-Term)

Catalog No. ABIN632615

Product Details anti-XRRA1 Antibody

Target: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRRA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: XRRA1 antibody was raised against the N terminal of XRRA1

Purification: Affinity purified

Immunogen: XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XRRA1 Blocking Peptide, catalog no. 33R-5652, is also available for use as a blocking control in assays to test for specificity of this XRRA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRRA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XRRA1

Target: XRRA1 (X-Ray Radiation Resistance Associated 1 (XRRA1))

Alternative Name: XRRA1 (XRRA1 Products)

Synonyms: AI449753 antibody, X-ray radiation resistance associated 1 antibody, Xrra1 antibody, XRRA1 antibody

Background: XRRA1 may be involved in the response of cells to X-ray radiation.

Molecular Weight: 90 kDa (MW of target protein)