C13orf30 antibody (N-Term)

Catalog No. ABIN632614

Product Details anti-C13orf30 Antibody

Target: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C13orf30 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C13 orf30 antibody was raised against the N terminal of C13 rf30

Purification: Affinity purified

Immunogen: C13 orf30 antibody was raised using the N terminal of C13 rf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C13orf30 Blocking Peptide, catalog no. 33R-6063, is also available for use as a blocking control in assays to test for specificity of this C13orf30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C13orf30

Target: C13orf30 (Chromosome 13 Open Reading Frame 30 (C13orf30))

Alternative Name: C13orf30 (C13orf30 Products)

Synonyms: C12H13orf30 antibody, C13orf30 antibody, 9330158N17 antibody, AU021034 antibody, family with sequence similarity 216 member B antibody, family with sequence similarity 216, member B antibody, FAM216B antibody, Fam216b antibody

Background: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 16 kDa (MW of target protein)