GBP2 antibody (N-Term)

Catalog No. ABIN632613

Product Details anti-GBP2 Antibody

Target: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GBP2 antibody was raised against the N terminal of GBP2

Purification: Affinity purified

Immunogen: GBP2 antibody was raised using the N terminal of GBP2 corresponding to a region with amino acids HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GBP2 Blocking Peptide, catalog no. 33R-3881, is also available for use as a blocking control in assays to test for specificity of this GBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GBP2

Target: GBP2 (Guanylate Binding Protein 2, Interferon-Inducible (GBP2))

Alternative Name: GBP2 (GBP2 Products)

Synonyms: guanylate binding protein 2 antibody, guanylate binding protein 2, interferon-inducible antibody, GTP binding protein 2 L homeolog antibody, GBP2 antibody, Gbp2 antibody, gtpbp2.L antibody

Background: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin