THYN1 antibody (N-Term)

Catalog No. ABIN632610

Product Details anti-THYN1 Antibody

Target: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THYN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: THYN1 antibody was raised against the N terminal of THYN1

Purification: Affinity purified

Immunogen: THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THYN1 Blocking Peptide, catalog no. 33R-6487, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THYN1

Target: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Alternative Name: THYN1 (THYN1 Products)

Synonyms: my105 antibody, thy28 antibody, mds012 antibody, hspc144 antibody, thy28kd antibody, zgc:66269 antibody, MDS012 antibody, MY105 antibody, THY28 antibody, THY28KD antibody, D730042P09Rik antibody, HSPC144 antibody, Thy28 antibody, thymocyte nuclear protein 1 antibody, Thymocyte nuclear protein 1 antibody, thyn1 antibody, THYN1 antibody, PTRG_09699 antibody, MCYG_02665 antibody, EIO_2684 antibody, thYN1 antibody, Thyn1 antibody

Background: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Molecular Weight: 26 kDa (MW of target protein)