THYN1 antibody (N-Term)
-
- Target See all THYN1 Antibodies
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This THYN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- THYN1 antibody was raised against the N terminal of THYN1
- Purification
- Affinity purified
- Immunogen
- THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL
- Top Product
- Discover our top product THYN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
THYN1 Blocking Peptide, catalog no. 33R-6487, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THYN1 (Thymocyte Nuclear Protein 1 (THYN1))
- Alternative Name
- THYN1 (THYN1 Products)
- Synonyms
- my105 antibody, thy28 antibody, mds012 antibody, hspc144 antibody, thy28kd antibody, zgc:66269 antibody, MDS012 antibody, MY105 antibody, THY28 antibody, THY28KD antibody, D730042P09Rik antibody, HSPC144 antibody, Thy28 antibody, thymocyte nuclear protein 1 antibody, Thymocyte nuclear protein 1 antibody, thyn1 antibody, THYN1 antibody, PTRG_09699 antibody, MCYG_02665 antibody, EIO_2684 antibody, thYN1 antibody, Thyn1 antibody
- Background
- THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.
- Molecular Weight
- 26 kDa (MW of target protein)
-