C3orf33 antibody (Middle Region)
-
- Target See all C3orf33 products
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C3orf33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C3 orf33 antibody was raised against the middle region of C3 rf33
- Purification
- Affinity purified
- Immunogen
- C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))
- Alternative Name
- C3orf33 (C3orf33 Products)
- Synonyms
- AC3-33 antibody, MGC99235 antibody, chromosome 3 open reading frame 33 antibody, chromosome 3 open reading frame 33 L homeolog antibody, RIKEN cDNA E130311K13 gene antibody, C3orf33 antibody, c3orf33.L antibody, E130311K13Rik antibody
- Background
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 29 kDa (MW of target protein)
-