ALDH7A1 antibody (N-Term)

Catalog No. ABIN632598

Product Details anti-ALDH7A1 Antibody

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH7A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDH7 A1 antibody was raised against the N terminal of ALDH7 1

Purification: Affinity purified

Immunogen: ALDH7 A1 antibody was raised using the N terminal of ALDH7 1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH7A1 Blocking Peptide, catalog no. 33R-6842, is also available for use as a blocking control in assays to test for specificity of this ALDH7A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH7A1

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Alternative Name: ALDH7A1 (ALDH7A1 Products)

Synonyms: atq1 antibody, ALDH7A1 antibody, ATQ1 antibody, EPD antibody, PDE antibody, antiquitin antibody, ATQ antibody, wu:fi34d12 antibody, wu:fi35e06 antibody, Atq1 antibody, D18Wsu181e antibody, aldehyde dehydrogenase 7 family member A1 antibody, aldehyde dehydrogenase 7 family member A1 L homeolog antibody, aldehyde dehydrogenase 7 family, member A1 antibody, aldehyde dehydrogenase family 7, member A1 antibody, ALDH7A1 antibody, aldh7a1 antibody, aldh7a1.L antibody, Aldh7a1 antibody

Background: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound