MTRR antibody (N-Term)

Catalog No. ABIN632593

Product Details anti-MTRR Antibody

Target: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTRR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MTRR antibody was raised against the N terminal of MTRR

Purification: Affinity purified

Immunogen: MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTRR Blocking Peptide, catalog no. 33R-10071, is also available for use as a blocking control in assays to test for specificity of this MTRR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTRR

Target: MTRR (5-Methyltetrahydrofolate-Homocysteine Methyltransferase Reductase (MTRR))

Alternative Name: MTRR (MTRR Products)

Synonyms: MSR antibody, 4732420G08 antibody, cblE antibody, MTRR antibody, 5-methyltetrahydrofolate-homocysteine methyltransferase reductase antibody, Mtrr antibody, MTRR antibody, mtrr antibody

Background: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process