FAM160B2 antibody (N-Term)

Catalog No. ABIN632592

Product Details anti-FAM160B2 Antibody

Target: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM160B2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAI16 antibody was raised against the N terminal of RAI16

Purification: Affinity purified

Immunogen: RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAI16 Blocking Peptide, catalog no. 33R-3883, is also available for use as a blocking control in assays to test for specificity of this RAI16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAI16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM160B2

Target: FAM160B2 (Family with Sequence Similarity 160, Member B2 (FAM160B2))

Alternative Name: RAI16 (FAM160B2 Products)

Synonyms: Rai16 antibody, RAI16 antibody, rai16 antibody, MGC146349 antibody, G430067P06Rik antibody, zgc:153945 antibody, family with sequence similarity 160, member B2 antibody, family with sequence similarity 160 member B2 antibody, Fam160b2 antibody, FAM160B2 antibody, fam160b2 antibody

Background: The function of RAI16 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 82 kDa (MW of target protein)