HS1BP3 antibody (N-Term)

Catalog No. ABIN632591

Product Details anti-HS1BP3 Antibody

Target: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HS1BP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HS1 BP3 antibody was raised against the N terminal of HS1 P3

Purification: Affinity purified

Immunogen: HS1 BP3 antibody was raised using the N terminal of HS1 P3 corresponding to a region with amino acids YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS1BP3 Blocking Peptide, catalog no. 33R-10239, is also available for use as a blocking control in assays to test for specificity of this HS1BP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HS1BP3

Target: HS1BP3 (HCLS1 Binding Protein 3 (HS1BP3))

Alternative Name: HS1BP3 (HS1BP3 Products)

Synonyms: HS1BP3 antibody, DKFZp468N116 antibody, ETM2 antibody, HS1-BP3 antibody, RGD1311331 antibody, HCLS1 binding protein 3 antibody, HCLS1 binding protein 3 S homeolog antibody, HS1BP3 antibody, hs1bp3.S antibody, hs1bp3 antibody, Hs1bp3 antibody

Background: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Molecular Weight: 43 kDa (MW of target protein)