WDFY1 antibody (N-Term)
-
- Target See all WDFY1 Antibodies
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WDFY1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WDFY1 antibody was raised against the N terminal of WDFY1
- Purification
- Affinity purified
- Immunogen
- WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
- Top Product
- Discover our top product WDFY1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WDFY1 Blocking Peptide, catalog no. 33R-5591, is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))
- Alternative Name
- WDFY1 (WDFY1 Products)
- Background
- The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.
- Molecular Weight
- 46 kDa (MW of target protein)
-